224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | C-C chemokine receptor type 9 |
|---|
Gene and Protein Information
| Gene ID | 10803 |
|---|---|
| Uniprot Accession IDs | P51686 Q4VBM3 Q549E0 Q9UQQ6 C-C CKR-9 |
| Ensembl ID | ENSP00000350256 |
| Symbol | GPR28 GPR28 CDw199 GPR-9-6 CC-CKR-9 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470808 | CCR9 | C-C motif chemokine receptor 9 | 9598 | VGNC:8829 | OMA, EggNOG |
| Macaque | 713934 | CCR9 | C-C motif chemokine receptor 9 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12769 | Ccr9 | chemokine (C-C motif) receptor 9 | 10090 | MGI:1341902 | Inparanoid, OMA, EggNOG |
| Rat | 282832 | Ccr9 | C-C motif chemokine receptor 9 | 10116 | RGD:628750 | Inparanoid, OMA, EggNOG |
| Dog | 484793 | CCR9 | C-C motif chemokine receptor 9 | 9615 | VGNC:38917 | Inparanoid, OMA, EggNOG |
| Horse | 100065535 | CCR9 | C-C motif chemokine receptor 9 | 9796 | VGNC:16231 | Inparanoid, OMA, EggNOG |
| Cow | 530951 | CCR9 | C-C motif chemokine receptor 9 | 9913 | VGNC:26989 | Inparanoid, OMA, EggNOG |
| Pig | 414377 | CCR9 | C-C motif chemokine receptor 9 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | CCR9 | C-C motif chemokine receptor 9 [Source:HGNC Symbol;Acc:HGNC:1610] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 428454 | CCR9 | C-C motif chemokine receptor 9 | 9031 | CGNC:8953 | Inparanoid, OMA |
| Anole lizard | CCR9 | C-C motif chemokine receptor 9 [Source:HGNC Symbol;Acc:HGNC:1610] | 28377 | Inparanoid, OMA | ||
| Zebrafish | 100006078 | ccr9b | chemokine (C-C motif) receptor 9b | 7955 | ZDB-GENE-070301-3 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-C chemokine receptor / C-c chemokine receptor type 9
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-C chemokine receptor / C-c chemokine receptor type 9
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.