Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.

Lenguaje

྾

224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

Inicio
Targets(Human)
POLR2E

POLR2E

Descripción	DNA-directed RNA polymerases I, II, and III subunit RPABC1

Gene and Protein Information

Gene ID	5434
Uniprot Accession IDs	P19388 B2R6L4 D6W5Y1 O43380 Q6PIH5 Q9BT06 RNA polymerases I, II, and III subunit ABC1
Ensembl ID	ENSP00000478303
Symbol	RPB5 XAP4 RPABC1 hRPB25 hsRPB5
Family	Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.
Sequence	MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Nombre	NIF	Other Gene ID	Sources
Chimp	456359	POLR2E	RNA polymerase II subunit E	9598		OMA, EggNOG
Macaque	721178	POLR2E	RNA polymerase II subunit E	9544		Inparanoid, OMA, EggNOG
Mouse	66420	Polr2e	polymerase (RNA) II (DNA directed) polypeptide E	10090	MGI:1913670	Inparanoid, OMA, EggNOG
Rat	690966	Polr2e	RNA polymerase II subunit E	10116	RGD:1589817	Inparanoid, OMA, EggNOG
Dog	611859	POLR2E	RNA polymerase II subunit E	9615	VGNC:44796	Inparanoid, OMA, EggNOG
Horse	100065431	POLR2E	RNA polymerase II subunit E	9796	VGNC:21677	Inparanoid, OMA, EggNOG
Cow	512971	POLR2E	RNA polymerase II subunit E	9913	VGNC:33139	Inparanoid, OMA, EggNOG
Pig	100623333	POLR2E	RNA polymerase II subunit E	9823		OMA, EggNOG
Opossum	100015794	POLR2E	RNA polymerase II subunit E	13616		Inparanoid, OMA, EggNOG
Chicken	420103	POLR2E	RNA polymerase II subunit E	9031	CGNC:1864	Inparanoid, OMA, EggNOG
Xenopus	549227	polr2e	polymerase (RNA) II (DNA directed) polypeptide E, 25kDa	8364	XB-GENE-1005304	Inparanoid, OMA, EggNOG
Zebrafish	445170	polr2eb	polymerase (RNA) II (DNA directed) polypeptide E, b	7955	ZDB-GENE-040801-83	Inparanoid, OMA, EggNOG
C. elegans	172412	rpb-5	DNA-directed RNA polymerases I, II, and III subunit RPABC1	6239		Inparanoid, OMA, EggNOG
Fruitfly	36160	Rpb5	CG11979 gene product from transcript CG11979-RB	7227	FBgn0033571	Inparanoid, EggNOG
S.cerevisiae	852451	RPB5	DNA-directed RNA polymerase core subunit RPB5	4932	S000000358	Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein / nucleic acid binding / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1
protein / nucleic acid binding / nucleotidyltransferase / DNA-directed RNA polymerases I, II, and III subunit RPABC1

DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / DNA-directed RNA polymerases I, II, and III subunit RPABC1

Associated Recombinant Proteins

Nombre	Specification and purity	Expression system	Protein label	Disponibilidad	Mostrar detalles

Associated Antibodies

Nombre	Specifications	Species reactivity	Aplicación	Disponibilidad	Mostrar detalles

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nombre	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.

Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.

POLR2E

Gene and Protein Information

Protein Classes

Associated Recombinant Proteins

Associated Antibodies

Related active small molecules

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Bibliography