RNF115

DescripciónE3 ubiquitin-protein ligase RNF115

Gene and Protein Information

Gene ID27246
Uniprot Accession IDs Q9Y4L5 A8K3Y4 Q5T2V9 Q7Z2J2
Ensembl ID ENSP00000463650
Symbol ZNF364 BCA2 ZNF364
Sequence
MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457980RNF115ring finger protein 1159598VGNC:1495OMA, EggNOG
Macaque697067RNF115ring finger protein 1159544Inparanoid, OMA
Mouse67845Rnf115ring finger protein 11510090MGI:1915095Inparanoid, OMA, EggNOG
Rat362002Rnf115ring finger protein 11510116RGD:1305315Inparanoid, OMA
Dog612818RNF115ring finger protein 1159615VGNC:45624Inparanoid, OMA, EggNOG
HorseRNF115ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154]9796OMA, EggNOG
Cow614061RNF115ring finger protein 1159913VGNC:34013Inparanoid, OMA, EggNOG
Opossum100012646RNF115ring finger protein 11513616Inparanoid, OMA, EggNOG
Xenopus100216180rnf115ring finger protein 1158364XB-GENE-993231Inparanoid, OMA, EggNOG
Zebrafish790928rnf115ring finger protein 1157955ZDB-GENE-061215-82Inparanoid, OMA, EggNOG
Fruitfly41080CG11982CG11982 gene product from transcript CG11982-RA7227FBgn0037653Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.