🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CEP70

DescripciónCentrosomal protein of 70 kDa

Gene and Protein Information

Gene ID80321
Uniprot Accession IDs Q8NHQ1 B7Z5I8 B7Z7E8 D3DNE9 F5GZX8 Q96B31 Q9H2C3 Q9H2Z1 Q9H940 Cep70
Ensembl ID ENSP00000264982
Symbol BITE BITE
Sequence
MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQQNKIKDLQKEQKTLQVKCQHYKKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVPHTVLDRQLLCLIDYYESKIRKIHTQRQYKEDESQSEEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALSSEKLNLQKDLETRPTQHELRLYKQQVKKLEKALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQRYFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQAIVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp460728CEP70centrosomal protein 709598VGNC:5039OMA, EggNOG
Macaque716263CEP70centrosomal protein 709544Inparanoid, OMA, EggNOG
Mouse68121Cep70centrosomal protein 7010090MGI:1915371Inparanoid, OMA, EggNOG
Rat367153Cep70centrosomal protein 7010116RGD:1561486Inparanoid, OMA, EggNOG
Dog477084CEP70centrosomal protein 709615VGNC:39135Inparanoid, OMA, EggNOG
Horse100064729CEP70centrosomal protein 709796VGNC:16425Inparanoid, OMA, EggNOG
Cow100301027CEP70centrosomal protein 709913VGNC:27211Inparanoid, OMA, EggNOG
Pig100621655CEP70centrosomal protein 709823Inparanoid, OMA, EggNOG
Opossum100024437CEP70centrosomal protein 7013616Inparanoid, OMA, EggNOG
Chicken429044CEP70centrosomal protein 709031CGNC:9165Inparanoid, OMA, EggNOG
Anole lizard100555185cep70centrosomal protein 7028377Inparanoid, OMA, EggNOG
Zebrafish100136857cep70centrosomal protein 707955ZDB-GENE-070705-311Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.