🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

STK26

DescripciónSerine/threonine-protein kinase 26

Gene and Protein Information

Gene ID51765
Uniprot Accession IDs Q9P289 B2RAU2 Q3ZB77 Q8NC04 Q9BXC3 Q9BXC4
Ensembl ID ENSP00000377867
Symbol MASK MST4 MASK MST4
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Sequence
MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp107971181STK26serine/threonine kinase 269598VGNC:12544OMA, EggNOG
Macaque707739STK26serine/threonine kinase 269544OMA, EggNOG
Mouse70415Stk26serine/threonine kinase 2610090MGI:1917665Inparanoid, OMA, EggNOG
Rat317589Stk26serine/threonine kinase 2610116RGD:1563568OMA, EggNOG
Dog492140STK26serine/threonine kinase 269615VGNC:46910OMA, EggNOG
Horse100057553STK26serine/threonine kinase 269796VGNC:23687OMA, EggNOG
Cow539445STK26serine/threonine kinase 269913VGNC:35392OMA, EggNOG
Pig100233205STK26serine/threonine kinase 269823OMA, EggNOG
Opossum100022479STK26serine/threonine kinase 2613616OMA, EggNOG
Platypus100084337STK26serine/threonine kinase 269258OMA, EggNOG
Chicken422231STK26serine/threonine protein kinase 269031CGNC:51666OMA, EggNOG
Anole lizard100557134stk26serine/threonine kinase 2628377OMA, EggNOG
Xenopus733529stk26serine/threonine kinase 268364XB-GENE-982067OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    STE group    /    STE20 family    /    YSK subfamily    /    Serine/threonine-protein kinase 26

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.