Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Spermine synthase |
|---|
Gene and Protein Information
| Gene ID | 6611 |
|---|---|
| Uniprot Accession IDs | P52788 A6NHA7 A6NI34 B2R9M0 O00544 Q9UQS1 SPMSY |
| Ensembl ID | ENSP00000385746 |
| Symbol | SRS SpS MRSR SPMSY |
| Family | Belongs to the spermidine/spermine synthase family. |
| Sequence | MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 698179 | SMS | spermine synthase | 9544 | Inparanoid, OMA | |
| Mouse | 20603 | Sms | spermine synthase | 10090 | MGI:109490 | Inparanoid, OMA, EggNOG |
| Rat | 363469 | Sms | spermine synthase | 10116 | RGD:1564826 | Inparanoid, OMA, EggNOG |
| Dog | 480861 | SMS | spermine synthase | 9615 | VGNC:54603 | Inparanoid, OMA, EggNOG |
| Horse | SMS | spermine synthase [Source:HGNC Symbol;Acc:HGNC:11123] | 9796 | OMA, EggNOG | ||
| Cow | 615950 | SMS | spermine synthase | 9913 | VGNC:35035 | Inparanoid, OMA, EggNOG |
| Pig | 100153052 | SMS | spermine synthase | 9823 | OMA, EggNOG | |
| Opossum | 100012760 | SMS | spermine synthase | 13616 | OMA, EggNOG | |
| Platypus | SMS | spermine synthase [Source:HGNC Symbol;Acc:HGNC:11123] | 9258 | OMA, EggNOG | ||
| Chicken | 418602 | SMS | spermine synthase | 9031 | CGNC:12257 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552713 | sms | spermine synthase | 28377 | OMA, EggNOG | |
| Xenopus | sms | spermine synthase [Source:Xenbase;Acc:XB-GENE-953534] | 8364 | OMA, EggNOG | ||
| Zebrafish | 80872 | sms | spermine synthase | 7955 | ZDB-GENE-040625-150 | Inparanoid, OMA, EggNOG |
| Fruitfly | 39403 | CG4300 | CG4300 gene product from transcript CG4300-RB | 7227 | FBgn0036272 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.