224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Metalloreductase STEAP1 |
|---|
Gene and Protein Information
| Gene ID | 26872 |
|---|---|
| Uniprot Accession IDs | Q9UHE8 A4D1E0 O95034 |
| Ensembl ID | ENSP00000297205 |
| Symbol | PRSS24 STEAP STEAP PRSS24 |
| Family | Belongs to the STEAP family. |
| Sequence | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463951 | STEAP1 | STEAP family member 1 | 9598 | VGNC:14465 | OMA, EggNOG |
| Macaque | 704448 | STEAP1 | STEAP family member 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 70358 | Steap1 | six transmembrane epithelial antigen of the prostate 1 | 10090 | MGI:1917608 | Inparanoid, OMA, EggNOG |
| Rat | 297738 | Steap1 | STEAP family member 1 | 10116 | RGD:1311543 | Inparanoid, OMA, EggNOG |
| Dog | 475222 | STEAP1 | STEAP family member 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100060223 | STEAP1 | STEAP family member 1 | 9796 | OMA, EggNOG | |
| Cow | 515156 | STEAP1 | STEAP family member 1 | 9913 | OMA, EggNOG | |
| Pig | 397573 | STEAP1 | STEAP family member 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100021193 | STEAP1 | STEAP family member 1 | 13616 | OMA, EggNOG | |
| Chicken | 420540 | STEAP1 | STEAP family member 1 | 9031 | CGNC:51279 | OMA, EggNOG |
| Anole lizard | 100564454 | steap1 | STEAP family member 1 | 28377 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.