🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SPTSSB

DescripciónSerine palmitoyltransferase small subunit B

Gene and Protein Information

Gene ID165679
Uniprot Accession IDs Q8NFR3 B2R5D3 D3DNM8 Q0P5S6
Ensembl ID ENSP00000352097
Symbol ADMP C3orf57 SSSPTB ADMP SSSPTB C3orf57
FamilyBelongs to the SPTSS family. SPTSSB subfamily.
Sequence
MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse66183Sptssbserine palmitoyltransferase, small subunit B10090MGI:1913433Inparanoid, OMA, EggNOG
Rat100362555Sptssbserine palmitoyltransferase, small subunit B10116RGD:2324614Inparanoid, OMA, EggNOG
Dog100683817SPTSSBserine palmitoyltransferase small subunit B9615VGNC:46782Inparanoid, OMA, EggNOG
Horse100630248SPTSSBserine palmitoyltransferase small subunit B9796VGNC:23562Inparanoid, OMA, EggNOG
Cow780785SPTSSBserine palmitoyltransferase small subunit B9913VGNC:35260Inparanoid, OMA, EggNOG
PigSPTSSBserine palmitoyltransferase small subunit B [Source:HGNC Symbol;Acc:HGNC:24045]9823OMA, EggNOG
Opossum100015052SPTSSBserine palmitoyltransferase small subunit B13616Inparanoid, OMA, EggNOG
Chicken425008SPTSSBserine palmitoyltransferase small subunit B9031CGNC:52313Inparanoid, OMA
Anole lizard103278170sptssbserine palmitoyltransferase small subunit B28377Inparanoid, OMA, EggNOG
Xenopus549969sptssbserine palmitoyltransferase small subunit B8364XB-GENE-950653Inparanoid, OMA, EggNOG
Zebrafish678546sptssbserine palmitoyltransferase, small subunit B7955ZDB-GENE-060421-6887Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.