The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
C8orf76 Descripción Uncharacterized protein C8orf76
Gene and Protein Information Gene ID 84933 Uniprot Accession IDs Q96K31 Q53HC1 Ensembl ID ENSP00000276704 Sequence MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 464367 C8H8orf76 chromosome 8 C8orf76 homolog 9598 VGNC:12154 OMA, EggNOG Mouse 75758 9130401M01Rik RIKEN cDNA 9130401M01 gene 10090 MGI:1923008 OMA, EggNOG Rat 314992 RGD1310852 similar to RIKEN cDNA 9130401M01 10116 RGD:1310852 OMA, EggNOG Dog 609286 C13H8orf76 chromosome 13 C8orf76 homolog 9615 OMA, EggNOG Horse 100057426 LOC100057426 uncharacterized protein C8orf76 9796 Inparanoid, OMA, EggNOG Cow 539014 C14H8orf76 chromosome 14 open reading frame, human C8orf76 9913 Inparanoid, OMA, EggNOG Pig 100517937 C4H8orf76 chromosome 4 C8orf76 homolog 9823 OMA, EggNOG Opossum 100032132 C3H8orf76 chromosome 3 open reading frame, human C8orf76 13616 OMA, EggNOG Platypus 100083916 LOC100083916 uncharacterized protein C8orf76-like 9258 OMA, EggNOG Anole lizard 100567945 LOC100567945 chromosome unknown open reading frame, human C8orf76 28377 OMA, EggNOG Xenopus 733825 c8orf76 chromosome 8 open reading frame 76 8364 XB-GENE-972589 OMA, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.