SSTR2

DescripciónSomatostatin receptor type 2

Gene and Protein Information

Gene ID6752
Uniprot Accession IDs P30874 A8K3Y0 B2R9P7 Q4VBP0 Q96GE0 Q96TF2 Q9BWH1 SS-2-R
Ensembl ID ENSP00000350198
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque695526SSTR2somatostatin receptor 29544Inparanoid, OMA, EggNOG
Mouse20606Sstr2somatostatin receptor 210090MGI:98328Inparanoid, OMA, EggNOG
Rat54305Sstr2somatostatin receptor 210116RGD:3763Inparanoid, OMA, EggNOG
Dog403472SSTR2somatostatin receptor 29615VGNC:46844Inparanoid, OMA, EggNOG
Horse100052744SSTR2somatostatin receptor 29796VGNC:23621Inparanoid, OMA, EggNOG
Cow282083SSTR2somatostatin receptor 29913VGNC:35326Inparanoid, OMA, EggNOG
PigSSTR2somatostatin receptor 2 [Source:HGNC Symbol;Acc:HGNC:11331]9823Inparanoid, OMA, EggNOG
Opossum100028527SSTR2somatostatin receptor 213616Inparanoid, OMA, EggNOG
Platypus100090283SSTR2somatostatin receptor 29258Inparanoid, OMA, EggNOG
Anole lizard100563000sstr2somatostatin receptor 228377Inparanoid, OMA
Xenopus100496382sstr2somatostatin receptor 28364XB-GENE-953419Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Somatostatin receptor type 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Somatostatin receptor type 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.