224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Somatostatin receptor type 5 |
|---|
Gene and Protein Information
| Gene ID | 6755 |
|---|---|
| Uniprot Accession IDs | P35346 P34988 Q541E0 Q9UJI5 SS-5-R |
| Ensembl ID | ENSP00000293897 |
| Symbol | SS-5-R |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 20609 | Sstr5 | somatostatin receptor 5 | 10090 | MGI:894282 | Inparanoid, OMA, EggNOG |
| Rat | 25354 | Sstr5 | somatostatin receptor 5 | 10116 | RGD:3765 | Inparanoid, OMA, EggNOG |
| Dog | 403454 | SSTR5 | somatostatin receptor 5 | 9615 | VGNC:46846 | Inparanoid, OMA, EggNOG |
| Horse | 100067398 | SSTR5 | somatostatin receptor 5 | 9796 | VGNC:23623 | Inparanoid, OMA, EggNOG |
| Cow | 510344 | SSTR5 | somatostatin receptor 5 | 9913 | VGNC:35328 | Inparanoid, OMA, EggNOG |
| Opossum | 100616853 | SSTR5 | somatostatin receptor 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | SSTR5 | somatostatin receptor 5 [Source:HGNC Symbol;Acc:HGNC:11334] | 9258 | OMA, EggNOG | ||
| Chicken | 427667 | SSTR5 | somatostatin receptor 5 | 9031 | CGNC:53162 | Inparanoid, OMA |
| Anole lizard | 100567150 | sstr5 | somatostatin receptor 5 | 28377 | Inparanoid, OMA | |
| Xenopus | 100486456 | sstr5 | somatostatin receptor 5 | 8364 | XB-GENE-949452 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Somatostatin receptor type 5
protein / G-protein coupled receptor / Class A rhodopsin like / Somatostatin receptor type 5
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.