224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Tumor necrosis factor receptor superfamily member 13B |
|---|
Gene and Protein Information
| Gene ID | 23495 |
|---|---|
| Uniprot Accession IDs | O14836 B2R8B0 B7Z6V8 Q32LX4 Q7Z6F5 |
| Ensembl ID | ENSP00000261652 |
| Symbol | TACI CVID RYZN TACI CD267 CVID2 IGAD2 TNFRSF14B |
| Sequence | MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 744388 | TNFRSF13B | TNF receptor superfamily member 13B | 9598 | VGNC:9727 | OMA, EggNOG |
| Mouse | 57916 | Tnfrsf13b | tumor necrosis factor receptor superfamily, member 13b | 10090 | MGI:1889411 | Inparanoid, OMA, EggNOG |
| Rat | 103693341 | Tnfrsf13b | TNF receptor superfamily member 13B | 10116 | RGD:1595998 | Inparanoid, OMA, EggNOG |
| Dog | 609580 | TNFRSF13B | TNF receptor superfamily member 13B | 9615 | VGNC:47657 | Inparanoid, OMA, EggNOG |
| Horse | TNFRSF13B | TNF receptor superfamily member 13B [Source:HGNC Symbol;Acc:HGNC:18153] | 9796 | OMA, EggNOG | ||
| Cow | TNFRSF13B | TNF receptor superfamily member 13B [Source:HGNC Symbol;Acc:HGNC:18153] | 9913 | OMA, EggNOG | ||
| Platypus | 100080237 | TNFRSF13B | TNF receptor superfamily member 13B | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 770275 | TNFRSF13B | TNF receptor superfamily member 13B | 9031 | CGNC:17053 | OMA, EggNOG |
| Anole lizard | 100560990 | tnfrsf13b | TNF receptor superfamily member 13B | 28377 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.