🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

TREM2

DescripciónTriggering receptor expressed on myeloid cells 2

Gene and Protein Information

Gene ID54209
Uniprot Accession IDs Q9NZC2 Q8N5H8 Q8WYN6 TREM-2
Ensembl ID ENSP00000362205
Symbol PLOSL2 TREM-2 Trem2a Trem2b Trem2c
Sequence
MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp748470TREM2triggering receptor expressed on myeloid cells 29598VGNC:3757OMA, EggNOG
Macaque719740TREM2triggering receptor expressed on myeloid cells 29544Inparanoid, OMA, EggNOG
Mouse83433Trem2triggering receptor expressed on myeloid cells 210090MGI:1913150Inparanoid, OMA, EggNOG
Rat301227Trem2triggering receptor expressed on myeloid cells 210116RGD:1309841Inparanoid, OMA, EggNOG
Dog474898TREM2triggering receptor expressed on myeloid cells 29615VGNC:47794Inparanoid, OMA, EggNOG
Horse100066180TREM2triggering receptor expressed on myeloid cells 29796VGNC:24482Inparanoid, OMA, EggNOG
Cow506467TREM2triggering receptor expressed on myeloid cells 29913VGNC:36299Inparanoid, OMA, EggNOG
Opossum100030137TREM2triggering receptor expressed on myeloid cells 213616Inparanoid, OMA, EggNOG
Anole lizard100561499LOC100561499triggering receptor expressed on myeloid cells 228377OMA, EggNOG
Xenopus100126214trem2triggering receptor expressed on myeloid cells 28364XB-GENE-922281Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.