Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.

Alternar navegación

Carrito

Buscar

Pedido rápido SDS / CoA Estructura A granel y personalizado

Comparar productos

Menú

Cuenta

Configuración

Idioma

྾

340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

Inicio
Targets(Human)
TREM2

TREM2

Descripción	Triggering receptor expressed on myeloid cells 2

Gene and Protein Information

Gene ID	54209
Uniprot Accession IDs	Q9NZC2 Q8N5H8 Q8WYN6 TREM-2
Ensembl ID	ENSP00000362205
Symbol	PLOSL2 TREM-2 Trem2a Trem2b Trem2c
Sequence	MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Nombre	NIF	Other Gene ID	Sources
Chimp	748470	TREM2	triggering receptor expressed on myeloid cells 2	9598	VGNC:3757	OMA, EggNOG
Macaque	719740	TREM2	triggering receptor expressed on myeloid cells 2	9544		Inparanoid, OMA, EggNOG
Mouse	83433	Trem2	triggering receptor expressed on myeloid cells 2	10090	MGI:1913150	Inparanoid, OMA, EggNOG
Rat	301227	Trem2	triggering receptor expressed on myeloid cells 2	10116	RGD:1309841	Inparanoid, OMA, EggNOG
Dog	474898	TREM2	triggering receptor expressed on myeloid cells 2	9615	VGNC:47794	Inparanoid, OMA, EggNOG
Horse	100066180	TREM2	triggering receptor expressed on myeloid cells 2	9796	VGNC:24482	Inparanoid, OMA, EggNOG
Cow	506467	TREM2	triggering receptor expressed on myeloid cells 2	9913	VGNC:36299	Inparanoid, OMA, EggNOG
Opossum	100030137	TREM2	triggering receptor expressed on myeloid cells 2	13616		Inparanoid, OMA, EggNOG
Anole lizard	100561499	LOC100561499	triggering receptor expressed on myeloid cells 2	28377		OMA, EggNOG
Xenopus	100126214	trem2	triggering receptor expressed on myeloid cells 2	8364	XB-GENE-922281	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Nombre	Specification and purity	Expression system	Protein label	Disponibilidad	Mostrar detalles

Associated Antibodies

Nombre	Especificaciones	Species reactivity	Aplicación	Disponibilidad	Mostrar detalles

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nombre	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

Recordármelo más tarde

¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

¡Vaya! Las notificaciones están desactivadas.

Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.

TREM2

Gene and Protein Information

Associated Recombinant Proteins

Associated Antibodies

Related active small molecules

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Bibliography