🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

SYPL1

DescripciónSynaptophysin-like protein 1

Gene and Protein Information

Gene ID6856
Uniprot Accession IDs Q16563 A4D0R2 Q96AR8
Ensembl ID ENSP00000011473
Symbol SYPL SYPL H-SP1
FamilyBelongs to the synaptophysin/synaptobrevin family.
Sequence
MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEIQVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVTFAVFVFLYCIAALLLYVGYTSLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKIATGHNIIDELPPCKKKAVLCYFGSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSAPHSQGGIPPPTGI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp463647SYPL1synaptophysin like 19598VGNC:8766OMA, EggNOG
Macaque698350SYPL1synaptophysin like 19544Inparanoid, OMA, EggNOG
Mouse19027Syplsynaptophysin-like protein10090MGI:108081Inparanoid, OMA, EggNOG
Rat366595Sypl1synaptophysin-like 110116RGD:1359569Inparanoid, OMA, EggNOG
Dog475889SYPL1synaptophysin like 19615VGNC:47039Inparanoid, OMA, EggNOG
Horse100059468SYPL1synaptophysin like 19796VGNC:23813Inparanoid, OMA, EggNOG
Cow615728SYPL1synaptophysin like 19913VGNC:53679Inparanoid, EggNOG
Pig100518030SYPL1synaptophysin like 19823OMA, EggNOG
OpossumSYPL1synaptophysin like 1 [Source:HGNC Symbol;Acc:HGNC:11507]13616Inparanoid, OMA, EggNOG
Platypus100091518SYPL1synaptophysin like 19258Inparanoid, OMA, EggNOG
Chicken417708SYPL1synaptophysin like 19031CGNC:66293Inparanoid, OMA
Anole lizard100561048sypl1synaptophysin like 128377OMA, EggNOG
Anole lizard100560276LOC100560276synaptophysin-like protein 128377Inparanoid, OMA
Xenopus394679sypl1synaptophysin-like 18364XB-GENE-942136Inparanoid, OMA, EggNOG
C. elegans177608sph-1SynaptoPHysin6239Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    membrane traffic protein    /    membrane trafficking regulatory protein    /    Synaptophysin-like protein 1
DTO Classes
protein    /    Transporter    /    Membrane trafficking regulatory protein    /    Synaptophysin-like protein 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.