🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

USP30

DescripciónUbiquitin carboxyl-terminal hydrolase 30

Gene and Protein Information

Gene ID84749
Uniprot Accession IDs Q70CQ3 Q8WTU7 Q96JX4 Q9BSS3
Ensembl ID ENSP00000257548
FamilyBelongs to the peptidase C19 family.
Sequence
MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452215USP30ubiquitin specific peptidase 309598VGNC:13490OMA, EggNOG
Macaque706607USP30ubiquitin specific peptidase 309544Inparanoid, OMA, EggNOG
Mouse100756Usp30ubiquitin specific peptidase 3010090MGI:2140991Inparanoid, OMA, EggNOG
Rat304579Usp30ubiquitin specific peptidase 3010116RGD:1307949Inparanoid, OMA, EggNOG
Dog611662USP30ubiquitin specific peptidase 309615VGNC:52974Inparanoid, OMA, EggNOG
Horse100066762USP30ubiquitin specific peptidase 309796VGNC:50985Inparanoid, OMA, EggNOG
Cow100140210USP30ubiquitin specific peptidase 309913VGNC:53928Inparanoid, OMA, EggNOG
Pig100520333ALKBH2alkB homolog 2, alpha-ketoglutarate dependent dioxygenase9823OMA, EggNOG
OpossumUSP30ubiquitin specific peptidase 30 [Source:HGNC Symbol;Acc:HGNC:20065]13616Inparanoid, OMA, EggNOG
PlatypusUSP30ubiquitin specific peptidase 30 [Source:HGNC Symbol;Acc:HGNC:20065]9258OMA, EggNOG
Xenopus733894usp30ubiquitin specific peptidase 308364XB-GENE-981069Inparanoid, OMA, EggNOG
Zebrafish559099usp30ubiquitin specific peptidase 307955ZDB-GENE-060526-335Inparanoid, OMA, EggNOG
C. elegans175310Y67D2.2Ubiquitin carboxyl-terminal hydrolase6239OMA, EggNOG
Fruitfly31519Usp30Ubiquitin specific protease 307227FBgn0029819Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.