🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

USP12

DescripciónUbiquitin carboxyl-terminal hydrolase 12

Gene and Protein Information

Gene ID219333
Uniprot Accession IDs O75317 A8K0X0 Q5VZV3 Q8TC49
Ensembl ID ENSP00000282344
Symbol UBH1 USP12L1 UBH1 USP12L1
FamilyBelongs to the peptidase C19 family. USP12/USP46 subfamily.
Sequence
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRD
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp735835USP12ubiquitin specific peptidase 129598VGNC:13155OMA, EggNOG
Macaque721611USP12ubiquitin specific peptidase 129544OMA, EggNOG
Mouse22217Usp12ubiquitin specific peptidase 1210090MGI:1270128Inparanoid, OMA, EggNOG
Rat360763Usp12ubiquitin specific peptidase 1210116RGD:1308045Inparanoid, OMA
Dog486033USP12ubiquitin specific peptidase 129615Inparanoid, OMA, EggNOG
Horse100060694USP12ubiquitin specific peptidase 129796VGNC:52453Inparanoid, OMA, EggNOG
Cow525655USP12ubiquitin specific peptidase 129913VGNC:52840Inparanoid, OMA, EggNOG
Pig100511469USP12ubiquitin specific peptidase 129823Inparanoid, OMA, EggNOG
Opossum100024908USP12ubiquitin specific peptidase 1213616OMA, EggNOG
PlatypusUSP12ubiquitin specific peptidase 12 [Source:HGNC Symbol;Acc:HGNC:20485]9258OMA, EggNOG
Anole lizardUSP12ubiquitin specific peptidase 12 [Source:HGNC Symbol;Acc:HGNC:20485]28377Inparanoid, OMA, EggNOG
Xenopus100494517usp12ubiquitin specific peptidase 128364XB-GENE-1009317Inparanoid, OMA, EggNOG
Zebrafish565736usp12aubiquitin specific peptidase 12a7955ZDB-GENE-060228-3Inparanoid, OMA, EggNOG
C. elegans176381usp-46Ubiquitin carboxyl-terminal hydrolase 466239Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.