Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | V-type proton ATPase subunit D |
|---|
Gene and Protein Information
| Gene ID | 51382 |
|---|---|
| Uniprot Accession IDs | Q9Y5K8 B2RE33 Q9Y688 V-ATPase subunit D |
| Ensembl ID | ENSP00000216442 |
| Symbol | ATP6M VATD VATD VMA8 ATP6M |
| Family | Belongs to the V-ATPase D subunit family. |
| Sequence | MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452979 | ATP6V1D | ATPase H+ transporting V1 subunit D | 9598 | VGNC:7643 | OMA, EggNOG |
| Macaque | 710240 | ATP6V1D | ATPase H+ transporting V1 subunit D | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 73834 | Atp6v1d | ATPase, H+ transporting, lysosomal V1 subunit D | 10090 | MGI:1921084 | Inparanoid, OMA, EggNOG |
| Rat | 299159 | Atp6v1d | ATPase H+ transporting V1 subunit D | 10116 | RGD:735119 | Inparanoid, OMA, EggNOG |
| Dog | 480360 | ATP6V1D | ATPase H+ transporting V1 subunit D | 9615 | VGNC:38280 | Inparanoid, OMA, EggNOG |
| Horse | 100052659 | ATP6V1D | ATPase H+ transporting V1 subunit D | 9796 | VGNC:15680 | Inparanoid, OMA, EggNOG |
| Cow | 404152 | ATP6V1D | ATPase H+ transporting V1 subunit D | 9913 | VGNC:26321 | Inparanoid, OMA, EggNOG |
| Platypus | 100074235 | ATP6V1D | ATPase H+ transporting V1 subunit D | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 423280 | ATP6V1D | ATPase H+ transporting V1 subunit D | 9031 | CGNC:7286 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555090 | atp6v1d | ATPase H+ transporting V1 subunit D | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549829 | atp6v1d | ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D | 8364 | XB-GENE-973447 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393935 | atp6v1d | ATPase H+ transporting V1 subunit D | 7955 | ZDB-GENE-040426-727 | Inparanoid, OMA, EggNOG |
| C. elegans | 176338 | vha-14 | V-type proton ATPase subunit D | 6239 | Inparanoid, OMA, EggNOG | |
| S.cerevisiae | 856659 | VMA8 | H(+)-transporting V1 sector ATPase subunit D | 4932 | S000000777 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit D
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit D
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.