224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Vesicular inhibitory amino acid transporter |
|---|
Gene and Protein Information
| Gene ID | 140679 |
|---|---|
| Uniprot Accession IDs | Q9H598 Q8N489 |
| Ensembl ID | ENSP00000217420 |
| Symbol | VGAT VIAAT VGAT VIAAT |
| Family | Belongs to the amino acid/polyamine transporter 2 family. |
| Sequence | MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYLTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPACYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469940 | SLC32A1 | solute carrier family 32 member 1 | 9598 | VGNC:9984 | OMA, EggNOG |
| Macaque | 698315 | SLC32A1 | solute carrier family 32 member 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22348 | Slc32a1 | solute carrier family 32 (GABA vesicular transporter), member 1 | 10090 | MGI:1194488 | Inparanoid, OMA, EggNOG |
| Rat | 83612 | Slc32a1 | solute carrier family 32 member 1 | 10116 | RGD:621402 | Inparanoid, OMA, EggNOG |
| Dog | 485870 | SLC32A1 | solute carrier family 32 member 1 | 9615 | VGNC:46356 | Inparanoid, OMA, EggNOG |
| Horse | 100146532 | SLC32A1 | solute carrier family 32 member 1 | 9796 | VGNC:23157 | Inparanoid, OMA, EggNOG |
| Cow | 100301361 | SLC32A1 | solute carrier family 32 member 1 | 9913 | VGNC:34815 | Inparanoid, OMA, EggNOG |
| Pig | 100517013 | SLC32A1 | solute carrier family 32 member 1 | 9823 | OMA, EggNOG | |
| Opossum | 100029278 | SLC32A1 | solute carrier family 32 member 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 419167 | SLC32A1 | solute carrier family 32 member 1 | 9031 | CGNC:2585 | Inparanoid, OMA |
| Anole lizard | 100553313 | slc32a1 | solute carrier family 32 member 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448348 | slc32a1 | solute carrier family 32 member 1 | 8364 | XB-GENE-489830 | Inparanoid, OMA, EggNOG |
| Zebrafish | 798575 | slc32a1 | solute carrier family 32 (GABA vesicular transporter), member 1 | 7955 | ZDB-GENE-061201-1 | Inparanoid, OMA, EggNOG |
| C. elegans | 176431 | unc-47 | Vesicular GABA transporter | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 36574 | VGAT | Vesicular GABA Transporter | 7227 | FBgn0033911 | Inparanoid, EggNOG |
| S.cerevisiae | 853457 | AVT1 | Avt1p | 4932 | S000003761 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transporter / amino acid transporter / Vesicular inhibitory amino acid transporter
protein / transporter / amino acid transporter / Vesicular inhibitory amino acid transporter
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC32 vesicular inhibitory amino acid transporter / Vesicular inhibitory amino acid transporter
protein / Transporter / SLC superfamily of solute carriers / SLC32 vesicular inhibitory amino acid transporter / Vesicular inhibitory amino acid transporter
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.