224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | NEDD8-conjugating enzyme UBE2F |
|---|
Gene and Protein Information
| Gene ID | 140739 |
|---|---|
| Uniprot Accession IDs | Q969M7 A8K1Z8 B4DDT9 B4DFI1 B4DMK3 B4DZU2 B8ZZG2 C9J212 H9KVB9 |
| Ensembl ID | ENSP00000478474 |
| Symbol | NCE2 NCE2 |
| Family | Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily. |
| Sequence | MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460054 | UBE2F | ubiquitin conjugating enzyme E2 F (putative) | 9598 | VGNC:14171 | OMA, EggNOG |
| Macaque | 695394 | UBE2F | ubiquitin conjugating enzyme E2 F (putative) | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 67921 | Ube2f | ubiquitin-conjugating enzyme E2F (putative) | 10090 | MGI:1915171 | Inparanoid, OMA, EggNOG |
| Rat | 363284 | Ube2f | ubiquitin-conjugating enzyme E2F (putative) | 10116 | RGD:1307608 | Inparanoid, OMA, EggNOG |
| Dog | 477421 | UBE2F | ubiquitin conjugating enzyme E2 F (putative) | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100057575 | UBE2F | ubiquitin conjugating enzyme E2 F (putative) | 9796 | OMA, EggNOG | |
| Cow | 617083 | UBE2F | ubiquitin conjugating enzyme E2 F (putative) | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100517862 | UBE2F | ubiquitin conjugating enzyme E2 F (putative) | 9823 | OMA, EggNOG | |
| Chicken | 424015 | UBE2F | ubiquitin conjugating enzyme E2 F (putative) | 9031 | CGNC:2790 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559377 | ube2f | ubiquitin conjugating enzyme E2 F (putative) | 28377 | OMA, EggNOG | |
| Xenopus | ube2f | ubiquitin conjugating enzyme E2F (putative) [Source:Xenbase;Acc:XB-GENE-960076] | 8364 | OMA, EggNOG | ||
| Zebrafish | 406606 | ube2f | ubiquitin-conjugating enzyme E2F (putative) | 7955 | ZDB-GENE-040426-2557 | Inparanoid, OMA, EggNOG |
| C. elegans | 173072 | ubc-12 | NEDD8-conjugating enzyme ubc-12 | 6239 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.