🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

TXNDC9

DescripciónThioredoxin domain-containing protein 9

Gene and Protein Information

Gene ID10190
Uniprot Accession IDs O14530 B2R9G8 D3DVI4 Q53HG4 Q53RV8 Q6NSF5 Q8TB70 Q9BRU6
Ensembl ID ENSP00000264255
Symbol APACD APACD PHLP3
Sequence
MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp744415TXNDC9thioredoxin domain containing 99598VGNC:406OMA, EggNOG
Macaque709303TXNDC9thioredoxin domain containing 99544Inparanoid, OMA, EggNOG
Mouse98258Txndc9thioredoxin domain containing 910090MGI:2138153Inparanoid, OMA
Rat280671Txndc9thioredoxin domain containing 910116RGD:708355Inparanoid, OMA, EggNOG
Dog474557TXNDC9thioredoxin domain containing 99615VGNC:48016Inparanoid, OMA, EggNOG
Horse100050502TXNDC9thioredoxin domain containing 99796VGNC:24682Inparanoid, OMA, EggNOG
Cow539143TXNDC9thioredoxin domain containing 99913VGNC:36540Inparanoid, OMA, EggNOG
Pig100520954TXNDC9thioredoxin domain containing 99823OMA, EggNOG
Opossum100012697TXNDC9thioredoxin domain containing 913616Inparanoid, OMA, EggNOG
Platypus100075216TXNDC9thioredoxin domain containing 99258Inparanoid, OMA, EggNOG
Anole lizard100553204txndc9thioredoxin domain containing 928377Inparanoid, OMA, EggNOG
Xenopus779993txndc9thioredoxin domain containing 98364XB-GENE-990778Inparanoid, OMA, EggNOG
Zebrafish336625txndc9thioredoxin domain containing 97955ZDB-GENE-030131-8569Inparanoid, OMA, EggNOG
C. elegans182257txdc-9Thioredoxin domain-containing protein 96239Inparanoid, OMA, EggNOG
Fruitfly41305CG4511CG4511 gene product from transcript CG4511-RA7227FBgn0037843Inparanoid, EggNOG
S.cerevisiae851764PLP1Plp1p4932S000002591Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    G-protein modulator    /    Thioredoxin domain-containing protein 9
protein    /    enzyme modulator    /    chaperone    /    Thioredoxin domain-containing protein 9
DTO Classes
protein    /    Enzyme modulator    /    G-protein modulator    /    Thioredoxin domain-containing protein 9

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.