🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

EIF5A

DescripciónEukaryotic translation initiation factor 5A-1

Gene and Protein Information

Gene ID1984
Uniprot Accession IDs P63241 A8K9A0 D3DTP2 P10159 Q16182 Q7L7L3 Q7Z4L1 Q9D0G2 eIF-5A-1
Ensembl ID ENSP00000336702
Symbol EIF-5A EIF5A1 eIF5AI
FamilyBelongs to the eIF-5A family.
Sequence
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque721812EIF5Aeukaryotic translation initiation factor 5A9544OMA, EggNOG
Mouse276770Eif5aeukaryotic translation initiation factor 5A10090MGI:106248Inparanoid, OMA, EggNOG
Rat287444Eif5aeukaryotic translation initiation factor 5A10116RGD:1308029Inparanoid, OMA
Dog489468EIF5Aeukaryotic translation initiation factor 5A9615Inparanoid, OMA, EggNOG
Horse100146743EIF5Aeukaryotic translation initiation factor 5A9796OMA, EggNOG
Cow444990EIF5Aeukaryotic translation initiation factor 5A9913Inparanoid, OMA, EggNOG
Opossum100015229EIF5Aeukaryotic translation initiation factor 5A13616OMA, EggNOG
Xenopus448142eif5aeukaryotic translation initiation factor 5A8364XB-GENE-998075OMA, EggNOG
Zebrafish406546eif5a2eukaryotic translation initiation factor 5A27955ZDB-GENE-040426-2405OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    translation initiation factor    /    Eukaryotic translation initiation factor 5A-1
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Translation factor    /    Translation initiation factor    /    Eukaryotic translation initiation factor 5A-1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.