IL32

DescripciónInterleukin-32

Gene and Protein Information

Gene ID9235
Uniprot Accession IDs P24001 A6NNM0 A8MPX0 B4DJM1 B8Q191 D3DUB0 D3DUB2 Q5VFH7 Q5VFH8 Q8WV38 Q96GK9 IL-32
Ensembl ID ENSP00000432218
Symbol NK4 TAIF NK4 TAIF TAIFa TAIFb TAIFc TAIFd IL-32beta IL-32alpha IL-32delta IL-32gamma
Sequence
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp100614360IL32interleukin 329598VGNC:13719OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.