ICOSLG

DescripciónICOS ligand

Gene and Protein Information

Gene ID102723996
Uniprot Accession IDs O75144 A8MUZ1 Q9HD18 Q9NRQ1
Ensembl ID ENSP00000483732
Symbol B7H2 B7RP1 ICOSL KIAA0653
FamilyBelongs to the immunoglobulin superfamily. BTN/MOG family.
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp474132ICOSLGinducible T-cell costimulator ligand9598OMA, EggNOG
Macaque722191ICOSLGinducible T-cell costimulator ligand9544Inparanoid, OMA, EggNOG
Mouse50723Icoslicos ligand10090MGI:1354701Inparanoid, EggNOG
Rat499415Icoslginducible T-cell co-stimulator ligand10116RGD:1562791Inparanoid, EggNOG
Dog487793ICOSLGinducible T-cell costimulator ligand9615Inparanoid, EggNOG
Cow507857ICOSLGinducible T-cell costimulator ligand9913Inparanoid, OMA, EggNOG
Pig100621467ICOSLGinducible T-cell costimulator ligand9823OMA, EggNOG
Anole lizard103278357icoslginducible T-cell costimulator ligand28377Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.