🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CEP57

DescripciónCentrosomal protein of 57 kDa

Gene and Protein Information

Gene ID9702
Uniprot Accession IDs Q86XR8 A0PJH1 A8K5D0 B4DDP5 F5H5F7 Q14704 Q5JB46 Q8IXP0 Q9BVF9 Cep57
Ensembl ID ENSP00000317902
Symbol KIAA0092 TSP57 MVA2 PIG8 TSP57
FamilyBelongs to the translokin family.
Sequence
MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451497CEP57centrosomal protein 579598VGNC:3153OMA, EggNOG
Macaque699835CEP57centrosomal protein 579544Inparanoid, OMA, EggNOG
Mouse74360Cep57centrosomal protein 5710090MGI:1915551Inparanoid, OMA, EggNOG
Rat315423Cep57centrosomal protein 5710116RGD:1309884Inparanoid, OMA, EggNOG
Dog476766CEP57centrosomal protein 579615VGNC:39131Inparanoid, OMA, EggNOG
Horse100067852CEP57centrosomal protein 579796VGNC:16421Inparanoid, OMA, EggNOG
Cow353245CEP57centrosomal protein 579913VGNC:27207Inparanoid, OMA, EggNOG
Opossum100013109CEP57centrosomal protein 5713616Inparanoid, OMA, EggNOG
Platypus100080301CEP57centrosomal protein 579258Inparanoid, OMA, EggNOG
Chicken418993CEP57centrosomal protein 579031CGNC:12924Inparanoid, OMA, EggNOG
Anole lizard100556771cep57centrosomal protein 5728377Inparanoid, OMA, EggNOG
Xenopuscep57centrosomal protein 57kDa [Source:Xenbase;Acc:XB-GENE-987031]8364OMA, EggNOG
Zebrafishcep57centrosomal protein 57 [Source:ZFIN;Acc:ZDB-GENE-070112-522]7955OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.