🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ID1

DescripciónDNA-binding protein inhibitor ID-1

Gene and Protein Information

Gene ID3397
Uniprot Accession IDs P41134 A8K537 E1P5L4 O00651 O00652 Q16371 Q16377 Q5TE66 Q5TE67 Q969Z7 Q9H0Z5 Q9H109
Ensembl ID ENSP00000365280
Symbol BHLHB24 Número de Identificación (ID) Número de Identificación (ID) bHLHb24
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469912ID1inhibitor of DNA binding 1, HLH protein9598VGNC:9871OMA, EggNOG
Macaque713160ID1inhibitor of DNA binding 1, HLH protein9544Inparanoid, OMA, EggNOG
Mouse15901Id1inhibitor of DNA binding 110090MGI:96396Inparanoid, OMA, EggNOG
Rat25261Id1inhibitor of DNA binding 1, HLH protein10116RGD:2858Inparanoid, OMA, EggNOG
Horse100068419ID1inhibitor of DNA binding 1, HLH protein9796VGNC:18934Inparanoid, OMA, EggNOG
Cow497011ID1inhibitor of DNA binding 1, HLH protein9913VGNC:30031Inparanoid, OMA, EggNOG
Opossum100010733ID1inhibitor of DNA binding 1, HLH protein13616Inparanoid, EggNOG
Zebrafish30493id1inhibitor of DNA binding 17955ZDB-GENE-990415-96Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.