🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ID2

DescripciónDNA-binding protein inhibitor ID-2

Gene and Protein Information

Gene ID3398
Uniprot Accession IDs Q02363
Ensembl ID ENSP00000234091
Symbol BHLHB26 GIG8 ID2A ID2H bHLHb26
Sequence
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque693394ID2inhibitor of DNA binding 29544Inparanoid, OMA, EggNOG
Mouse15902Id2inhibitor of DNA binding 210090MGI:96397Inparanoid, OMA, EggNOG
Rat25587Id2inhibitor of DNA binding 210116RGD:2859Inparanoid, OMA, EggNOG
Horse100057240ID2inhibitor of DNA binding 29796VGNC:51321Inparanoid, OMA, EggNOG
Cow505025ID2inhibitor of DNA binding 29913Inparanoid, OMA, EggNOG
Pig654298ID2inhibitor of DNA binding 29823Inparanoid, OMA, EggNOG
Opossum100028188ID2inhibitor of DNA binding 213616Inparanoid, EggNOG
Platypus100084227ID2inhibitor of DNA binding 29258Inparanoid, OMA, EggNOG
Xenopus394480id2inhibitor of DNA binding 28364XB-GENE-481297Inparanoid, OMA, EggNOG
Zebrafish266599id2ainhibitor of DNA binding 2a7955ZDB-GENE-020910-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.