🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

IL1B

DescripciónInterleukin-1 beta

Gene and Protein Information

Gene ID3553
Uniprot Accession IDs P01584 Q53X59 Q53XX2 Q7M4S7 Q7RU01 Q96HE5 Q9UCT6 IL-1 beta
Ensembl ID ENSP00000263341
Symbol IL1F2 IL-1 IL1F2 IL1-BETA
FamilyBelongs to the IL-1 family.
Sequence
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp450200IL1Binterleukin 1 beta9598VGNC:1940OMA, EggNOG
Mouse16176Il1binterleukin 1 beta10090MGI:96543Inparanoid, OMA, EggNOG
Rat24494Il1binterleukin 1 beta10116RGD:2891Inparanoid, OMA, EggNOG
Dog403974IL1Binterleukin 1 beta9615VGNC:41957Inparanoid, OMA, EggNOG
Cow281251IL1Binterleukin 1 beta9913VGNC:52787Inparanoid, OMA, EggNOG
Pig110258578LOC110258578interleukin-1 beta-like9823OMA, EggNOG
Opossum100026024IL1Binterleukin 1 beta13616Inparanoid, EggNOG
Platypus103165286IL1Binterleukin 1 beta9258OMA, EggNOG
Xenopus100487038il1binterleukin 1 beta8364XB-GENE-481756Inparanoid, OMA, EggNOG
Zebrafish405770il1binterleukin 1, beta7955ZDB-GENE-040702-2Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.