224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Interferon-induced transmembrane protein 1 |
|---|
Gene and Protein Information
| Gene ID | 8519 |
|---|---|
| Uniprot Accession IDs | P13164 Q15322 Q53XZ0 |
| Ensembl ID | ENSP00000386187 |
| Symbol | CD225 IFI17 9-27 CD225 IFI17 LEU13 DSPA2a |
| Family | Belongs to the CD225/Dispanin family. |
| Sequence | MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100526663 | IFITM1 | interferon induced transmembrane protein 1 | 9598 | VGNC:1071 | Inparanoid, OMA, EggNOG |
| Macaque | 697687 | IFITM1 | interferon induced transmembrane protein 1 | 9544 | OMA, EggNOG | |
| Cow | 615833 | IFITM2 | interferon induced transmembrane protein 2 (1-8D) | 9913 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.