🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

IL22

DescripciónInterleukin-22

Gene and Protein Information

Gene ID50616
Uniprot Accession IDs Q9GZX6 IL-22
Ensembl ID ENSP00000442424
Symbol ILTIF ZCYTO18 TIFa IL-21 IL-22 ILTIF IL-TIF IL-D110 zcyto18 TIFIL-23
FamilyBelongs to the IL-10 family.
Sequence
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp741423IL22interleukin 229598VGNC:5429OMA, EggNOG
Macaque718047IL22interleukin 229544Inparanoid, OMA, EggNOG
Mouse50929Il22interleukin 2210090MGI:1355307OMA, EggNOG
Mouse116849Iltifbinterleukin 10-related T cell-derived inducible factor beta10090MGI:2151139Inparanoid, OMA
Rat500836Il22interleukin 2210116RGD:1561292Inparanoid, OMA, EggNOG
Dog481153IL22interleukin 229615VGNC:41969Inparanoid, OMA, EggNOG
Horse100058976IL22interleukin 229796VGNC:19018Inparanoid, OMA, EggNOG
Cow507778IL22interleukin 229913VGNC:30143OMA, EggNOG
Pig595104IL22interleukin 229823Inparanoid, OMA, EggNOG
Platypus100080327IL22interleukin 229258Inparanoid, OMA, EggNOG
Chicken417838IL22interleukin 229031CGNC:7522Inparanoid, OMA, EggNOG
Anole lizard100556133il22interleukin 2228377Inparanoid, OMA, EggNOG
Xenopus100216308il22interleukin 228364Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.