EBI3

DescripciónInterleukin-27 subunit beta

Gene and Protein Information

Gene ID10148
Uniprot Accession IDs Q14213 A0N0N2 O75269 IL-27 subunit beta
Ensembl ID ENSP00000221847
Symbol IL27B IL27B IL35B IL-27B
FamilyBelongs to the type I cytokine receptor family. Type 3 subfamily.
Sequence
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp737135EBI3Epstein-Barr virus induced 39598OMA, EggNOG
Mouse50498Ebi3Epstein-Barr virus induced gene 310090MGI:1354171Inparanoid, OMA, EggNOG
Rat680609Ebi3Epstein-Barr virus induced 310116RGD:1589467Inparanoid, OMA, EggNOG
Dog485043EBI3Epstein-Barr virus induced 39615Inparanoid, OMA, EggNOG
Horse100063061EBI3Epstein-Barr virus induced 39796Inparanoid, OMA, EggNOG
Cow514933EBI3Epstein-Barr virus induced 39913Inparanoid, OMA, EggNOG
Pig100522599EBI3Epstein-Barr virus induced 39823OMA, EggNOG
Opossum100022641EBI3Epstein-Barr virus induced 313616Inparanoid, OMA, EggNOG
Anole lizard100567370LOC100567370interleukin-27 subunit beta28377OMA, EggNOG
Xenopus100486938ebi3Epstein-Barr virus induced 38364XB-GENE-984416Inparanoid, OMA, EggNOG
Zebrafish100134974ebi3Epstein-Barr virus induced 37955ZDB-GENE-070912-615Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    defense/immunity protein    /    Interleukin-27 subunit beta
protein    /    signaling molecule    /    cytokine    /    Interleukin-27 subunit beta
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin-27 subunit beta

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.