ME2

DescripciónNAD-dependent malic enzyme, mitochondrial

Gene and Protein Information

Gene ID4200
Uniprot Accession IDs P23368 B2R8J2 Q9BWL6 Q9BYG1 Q9H4B2 NAD-ME
Ensembl ID ENSP00000321070
Symbol ODS1
FamilyBelongs to the malic enzymes family.
Sequence
MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455422ME2malic enzyme 29598VGNC:10005OMA, EggNOG
Macaque711129ME2malic enzyme 29544Inparanoid, OMA, EggNOG
Mouse107029Me2malic enzyme 2, NAD(+)-dependent, mitochondrial10090MGI:2147351Inparanoid, OMA, EggNOG
Rat307270Me2malic enzyme 210116RGD:1310321Inparanoid, OMA, EggNOG
Dog476198ME2malic enzyme 29615VGNC:43110Inparanoid, OMA, EggNOG
Horse100069637ME2malic enzyme 29796VGNC:20062Inparanoid, OMA, EggNOG
Cow507817ME2malic enzyme 29913VGNC:31340Inparanoid, OMA, EggNOG
Pig100524659ME2malic enzyme 29823Inparanoid, OMA, EggNOG
Opossum100010878ME2malic enzyme 213616Inparanoid, OMA, EggNOG
Platypus100078022ME2malic enzyme 29258Inparanoid, OMA, EggNOG
Anole lizard100552684me2malic enzyme 228377Inparanoid, OMA, EggNOG
Xenopus548395me2malic enzyme 2, NAD(+)-dependent, mitochondrial8364XB-GENE-943055Inparanoid, OMA, EggNOG
Zebrafish445233me2malic enzyme 2, NAD(+)-dependent, mitochondrial7955ZDB-GENE-040801-147Inparanoid, OMA
S.cerevisiae853839MAE1malate dehydrogenase (oxaloacetate-decarboxylating)4932S000001512Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    NAD-dependent malic enzyme, mitochondrial
protein    /    oxidoreductase    /    decarboxylase    /    NAD-dependent malic enzyme, mitochondrial
protein    /    oxidoreductase    /    acyltransferase    /    NAD-dependent malic enzyme, mitochondrial
DTO Classes
protein    /    Enzyme    /    Lyase    /    Decarboxylase    /    NAD-dependent malic enzyme, mitochondrial

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.