🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

IL17A

DescripciónInterleukin-17A

Gene and Protein Information

Gene ID3605
Uniprot Accession IDs Q16552 Q5T2P0 IL-17
Ensembl ID ENSP00000344192
Symbol CTLA8 IL17 IL17 CTLA8 IL-17 CTLA-8 IL-17A
FamilyBelongs to the IL-17 family.
Sequence
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp472029IL17Ainterleukin 17A9598VGNC:3123OMA, EggNOG
Macaque708123IL17Ainterleukin 17A9544Inparanoid, OMA, EggNOG
Mouse16171Il17ainterleukin 17A10090MGI:107364Inparanoid, OMA, EggNOG
Rat301289Il17ainterleukin 17A10116RGD:2888Inparanoid, OMA, EggNOG
Dog481837IL17Ainterleukin 17A9615VGNC:41942OMA, EggNOG
Horse100034142IL17Ainterleukin 17A9796VGNC:19000OMA, EggNOG
Cow282863IL17Ainterleukin 17A9913VGNC:30117Inparanoid, OMA, EggNOG
Pig449530IL17Ainterleukin 17A9823Inparanoid, OMA, EggNOG
Opossum100016267IL17Ainterleukin 17A13616Inparanoid, OMA, EggNOG
Platypus100078889IL17Ainterleukin 17A9258Inparanoid, OMA, EggNOG
Chicken428665IL17Finterleukin 17F9031CGNC:53428Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.