🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

IGF1

DescripciónInsulin-like growth factor I

Gene and Protein Information

Gene ID3479
Uniprot Accession IDs P05019 B2RWM7 E9PD02 P01343 Q14620 IGF-I
Ensembl ID ENSP00000302665
Symbol IBP1 IGF MGF IGFI IGF-I
FamilyBelongs to the insulin family.
Sequence
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp741055IGF1insulin like growth factor 19598VGNC:5427OMA, EggNOG
Macaque698444IGF1insulin like growth factor 19544Inparanoid, OMA, EggNOG
Mouse16000Igf1insulin-like growth factor 110090MGI:96432Inparanoid, OMA, EggNOG
Rat24482Igf1insulin-like growth factor 110116RGD:2868Inparanoid, OMA, EggNOG
Dog610255IGF1insulin like growth factor 19615VGNC:41895Inparanoid, OMA, EggNOG
Horse100034198IGF1insulin like growth factor 19796VGNC:18967Inparanoid, OMA, EggNOG
Cow281239IGF1insulin like growth factor 19913VGNC:30076Inparanoid, OMA, EggNOG
Pig397491IGF1insulin like growth factor 19823Inparanoid, OMA, EggNOG
Opossum100021295IGF1insulin like growth factor 113616Inparanoid, OMA, EggNOG
Platypus100075905IGF1insulin like growth factor 19258Inparanoid, OMA, EggNOG
Chicken418090IGF1insulin like growth factor 19031CGNC:9671Inparanoid, OMA, EggNOG
Anole lizard100566682igf1insulin like growth factor 128377Inparanoid, OMA, EggNOG
Xenopus100486334igf1insulin like growth factor 18364XB-GENE-480239Inparanoid, OMA, EggNOG
Zebrafish114433igf1insulin-like growth factor 17955ZDB-GENE-010607-2Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.