224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Proto-oncogene c-Fos |
|---|
Gene and Protein Information
| Gene ID | 2353 |
|---|---|
| Uniprot Accession IDs | P01100 A8K4E2 B4DQ65 P18849 |
| Ensembl ID | ENSP00000306245 |
| Symbol | G0S7 p55 AP-1 C-FOS |
| Family | Belongs to the bZIP family. Fos subfamily. |
| Sequence | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 14281 | Fos | FBJ osteosarcoma oncogene | 10090 | MGI:95574 | Inparanoid, OMA, EggNOG |
| Rat | 314322 | Fos | Fos proto-oncogene, AP-1 transcription factor subunit | 10116 | RGD:2626 | Inparanoid, OMA, EggNOG |
| Dog | 490792 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9615 | VGNC:40940 | Inparanoid, OMA, EggNOG |
| Horse | 100051632 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9796 | VGNC:18095 | Inparanoid, OMA, EggNOG |
| Cow | 280795 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9913 | VGNC:29073 | Inparanoid, OMA, EggNOG |
| Pig | 100144486 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018285 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 13616 | Inparanoid, EggNOG | |
| Platypus | 100075021 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 396512 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9031 | CGNC:49845 | Inparanoid, OMA |
| Anole lizard | 100556427 | fos | Fos proto-oncogene, AP-1 transcription factor subunit | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548954 | fos | FBJ murine osteosarcoma viral oncogene homolog | 8364 | XB-GENE-866811 | Inparanoid, OMA, EggNOG |
| Zebrafish | 394198 | fosab | v-fos FBJ murine osteosarcoma viral oncogene homolog Ab | 7955 | ZDB-GENE-031222-4 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.