🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GALE

DescripciónUDP-glucose 4-epimerase

Gene and Protein Information

Gene ID2582
Uniprot Accession IDs Q14376 A0A024RAH5 B3KQ39 Q38G75 Q86W41 Q9BVE3 Q9UJB4
Ensembl ID ENSP00000483375
Symbol SDR1E1
FamilyBelongs to the NAD(P)-dependent epimerase/dehydratase family.
Sequence
MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp456623GALEUDP-galactose-4-epimerase9598VGNC:11436OMA, EggNOG
Macaque710553GALEUDP-galactose-4-epimerase9544Inparanoid, OMA, EggNOG
Mouse74246Galegalactose-4-epimerase, UDP10090MGI:1921496Inparanoid, OMA, EggNOG
Rat114860GaleUDP-galactose-4-epimerase10116RGD:621493Inparanoid, OMA
Dog100855555GALEUDP-galactose-4-epimerase9615VGNC:41080Inparanoid, OMA, EggNOG
Horse100057723GALEUDP-galactose-4-epimerase9796VGNC:18218Inparanoid, OMA, EggNOG
Cow523154GALEUDP-galactose-4-epimerase9913VGNC:29218Inparanoid, OMA, EggNOG
Pig100621392GALEUDP-galactose-4-epimerase9823Inparanoid, OMA, EggNOG
Opossum100010009GALEUDP-galactose-4-epimerase13616Inparanoid, OMA, EggNOG
Chicken419686GALEUDP-galactose-4-epimerase9031CGNC:2971Inparanoid, OMA, EggNOG
Anole lizard100562252galeUDP-galactose-4-epimerase28377Inparanoid, OMA, EggNOG
Xenopus448443galeUDP-galactose-4-epimerase8364XB-GENE-965029Inparanoid, OMA, EggNOG
Zebrafish678540galeUDP-galactose-4-epimerase7955ZDB-GENE-060421-6479Inparanoid, OMA, EggNOG
C. elegans173171gale-1UDP-GALactose 4-Epimerase6239Inparanoid, OMA, EggNOG
Fruitfly38076GaleUDP-galactose 4'-epimerase7227FBgn0035147Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.