🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FFAR2

DescripciónFree fatty acid receptor 2

Gene and Protein Information

Gene ID2867
Uniprot Accession IDs O15552 B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5
Ensembl ID ENSP00000473159
Symbol FFA2 GPCR43 GPR43 FFA2R GPR43
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455948FFAR2free fatty acid receptor 29598VGNC:11096OMA, EggNOG
Macaque709026FFAR2free fatty acid receptor 29544Inparanoid, OMA, EggNOG
Mouse233079Ffar2free fatty acid receptor 210090MGI:2441731Inparanoid, OMA, EggNOG
Rat292794Ffar2free fatty acid receptor 210116RGD:1359614Inparanoid, OMA, EggNOG
Dog484580FFAR2free fatty acid receptor 29615VGNC:40831Inparanoid, OMA, EggNOG
Horse100059449FFAR2free fatty acid receptor 29796VGNC:51028Inparanoid, OMA, EggNOG
Cow522431FFAR2free fatty acid receptor 29913OMA, EggNOG
Opossum100015816FFAR2free fatty acid receptor 213616Inparanoid, OMA, EggNOG
PlatypusFFAR2free fatty acid receptor 2 [Source:HGNC Symbol;Acc:HGNC:4501]9258OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Free fatty acid receptor    /    Free fatty acid receptor 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.