224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Ectonucleoside triphosphate diphosphohydrolase 5 |
|---|
Gene and Protein Information
| Gene ID | 957 |
|---|---|
| Uniprot Accession IDs | O75356 A1L4C5 Q96RX0 NTPDase 5 |
| Ensembl ID | ENSP00000335246 |
| Symbol | CD39L4 PCPH PCPH CD39L4 NTPDase-5 |
| Family | Belongs to the GDA1/CD39 NTPase family. |
| Sequence | MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 453027 | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 | 9598 | VGNC:3433 | OMA, EggNOG |
| Macaque | 698503 | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12499 | Entpd5 | ectonucleoside triphosphate diphosphohydrolase 5 | 10090 | MGI:1321385 | Inparanoid, OMA, EggNOG |
| Rat | 314312 | Entpd5 | ectonucleoside triphosphate diphosphohydrolase 5 | 10116 | RGD:735219 | Inparanoid, OMA, EggNOG |
| Dog | 480384 | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 | 9615 | VGNC:40384 | Inparanoid, OMA, EggNOG |
| Horse | 100056466 | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 | 9796 | VGNC:17599 | Inparanoid, OMA, EggNOG |
| Cow | 533096 | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 | 9913 | VGNC:28511 | Inparanoid, OMA, EggNOG |
| Pig | 100154506 | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100024118 | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 | 13616 | Inparanoid, EggNOG | |
| Chicken | 423343 | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 | 9031 | CGNC:7759 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555642 | entpd5 | ectonucleoside triphosphate diphosphohydrolase 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | ENTPD5 | ectonucleoside triphosphate diphosphohydrolase 5 [Source:HGNC Symbol;Acc:HGNC:3367] | 8364 | OMA, EggNOG | ||
| Zebrafish | 100334492 | entpd5b | ectonucleoside triphosphate diphosphohydrolase 5b | 7955 | ZDB-GENE-091118-88 | Inparanoid, OMA, EggNOG |
| C. elegans | 179395 | uda-1 | Nucleoside-diphosphatase uda-1 | 6239 | OMA, EggNOG | |
| S.cerevisiae | 856669 | GDA1 | guanosine diphosphatase | 4932 | S000000768 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.