🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

FGFR1OP

DescripciónFGFR1 oncogene partner

Gene and Protein Information

Gene ID11116
Uniprot Accession IDs O95684 A8K1D1 B2R705 Q49AI0 Q5R3F6 Q96EW1
Ensembl ID ENSP00000355812
Symbol FOP FOP
FamilyBelongs to the FGFR1OP family.
Sequence
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp472222FGFR1OPFGFR1 oncogene partner9598VGNC:14366OMA, EggNOG
Macaque706749FGFR1OPFGFR1 oncogene partner9544Inparanoid, OMA, EggNOG
Mouse75296Fgfr1opFgfr1 oncogene partner10090MGI:1922546Inparanoid, OMA, EggNOG
Rat683722Fgfr1opFgfr1 oncogene partner10116RGD:1583370Inparanoid, OMA
Dog612453FGFR1OPFGFR1 oncogene partner9615VGNC:40857Inparanoid, OMA, EggNOG
Horse100055208FGFR1OPFGFR1 oncogene partner9796VGNC:18023Inparanoid, OMA, EggNOG
Cow506246FGFR1OPFGFR1 oncogene partner9913VGNC:28985Inparanoid, OMA, EggNOG
Pig100153548FGFR1OPFGFR1 oncogene partner9823OMA, EggNOG
Opossum100032603FGFR1OPFGFR1 oncogene partner13616OMA, EggNOG
Chicken421568FGFR1OPFGFR1 oncogene partner9031CGNC:8680Inparanoid, OMA, EggNOG
Anole lizard100552966fgfr1opFGFR1 oncogene partner28377Inparanoid, OMA, EggNOG
Xenopus549512fgfr1opFGFR1 oncogene partner8364XB-GENE-5752647Inparanoid, OMA, EggNOG
Zebrafish415215fgfr1opFGFR1 oncogene partner7955ZDB-GENE-090417-1OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.