224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Folate receptor beta |
|---|
Gene and Protein Information
| Gene ID | 2350 |
|---|---|
| Uniprot Accession IDs | P14207 Q05CA5 Q6GTE8 FR-beta |
| Ensembl ID | ENSP00000298223 |
| Symbol | FBP FR-P3 FR-BETA BETA-HFR FBP/PL-1 |
| Family | Belongs to the folate receptor family. |
| Sequence | MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100614013 | FOLR2 | folate receptor beta | 9598 | VGNC:10189 | OMA, EggNOG |
| Macaque | 718405 | FOLR2 | folate receptor beta | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14276 | Folr2 | folate receptor 2 (fetal) | 10090 | MGI:95569 | OMA, EggNOG |
| Rat | 293154 | Folr2 | folate receptor beta | 10116 | RGD:1308515 | Inparanoid, OMA, EggNOG |
| Cow | 507672 | FOLR2 | folate receptor 2 (fetal) | 9913 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.