🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

HES5

DescripciónTranscription factor HES-5

Gene and Protein Information

Gene ID388585
Uniprot Accession IDs Q5TA89 B9DI85
Ensembl ID ENSP00000367714
Symbol BHLHB38 bHLHb38
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp107973860HES5hes family bHLH transcription factor 59598VGNC:11446OMA, EggNOG
Mouse15208Hes5hes family bHLH transcription factor 510090MGI:104876Inparanoid, OMA, EggNOG
Rat79225Hes5hes family bHLH transcription factor 510116RGD:621340Inparanoid, OMA, EggNOG
Dog489614HES5hes family bHLH transcription factor 59615VGNC:41666Inparanoid, OMA, EggNOG
Cow787633HES5hes family bHLH transcription factor 59913VGNC:29822Inparanoid, OMA, EggNOG
Opossum100027928HES5hes family bHLH transcription factor 513616Inparanoid, OMA, EggNOG
Chicken419392HES5hes family bHLH transcription factor 59031CGNC:773Inparanoid, OMA, EggNOG
Anole lizard100562263hes5hes family bHLH transcription factor 528377Inparanoid, OMA, EggNOG
Xenopus733463hes5.1hes family bHLH transcription factor 58364XB-GENE-481135Inparanoid, OMA
Xenopus100271766hes8hairy and enhancer of split 88364XB-GENE-5952810OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.