🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FOSL1

DescripciónFos-related antigen 1

Gene and Protein Information

Gene ID8061
Uniprot Accession IDs P15407 B4DR11 Q6FG51 FRA-1
Ensembl ID ENSP00000310170
Symbol FRA1 FRA FRA1 fra-1
FamilyBelongs to the bZIP family. Fos subfamily.
Sequence
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp745919FOSL1FOS like 1, AP-1 transcription factor subunit9598VGNC:6556OMA, EggNOG
Macaque106993191FOSL1FOS like 1, AP-1 transcription factor subunit9544OMA, EggNOG
Mouse14283Fosl1fos-like antigen 110090MGI:107179Inparanoid, OMA, EggNOG
Rat25445Fosl1FOS like 1, AP-1 transcription factor subunit10116RGD:2627Inparanoid, OMA, EggNOG
Dog483724FOSL1FOS like 1, AP-1 transcription factor subunit9615VGNC:40942Inparanoid, OMA, EggNOG
Horse100051930FOSL1FOS like 1, AP-1 transcription factor subunit9796VGNC:18097Inparanoid, OMA, EggNOG
Cow531389FOSL1FOS like 1, AP-1 transcription factor subunit9913VGNC:29075Inparanoid, OMA, EggNOG
Pig100525205FOSL1FOS like 1, AP-1 transcription factor subunit9823OMA, EggNOG
Anole lizard100552821fosbFosB proto-oncogene, AP-1 transcription factor subunit28377OMA, EggNOG
Xenopus100038288fosl1FOS-like antigen 18364XB-GENE-6257957Inparanoid, OMA, EggNOG
Zebrafish564241fosl1aFOS-like antigen 1a7955ZDB-GENE-061207-7OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.