224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Hepatocyte nuclear factor 3-alpha |
|---|
Gene and Protein Information
| Gene ID | 3169 |
|---|---|
| Uniprot Accession IDs | P55317 B2R9H6 B7ZAP5 Q9H2A0 HNF-3-alpha |
| Ensembl ID | ENSP00000250448 |
| Symbol | HNF3A TCF3A HNF3A TCF3A |
| Sequence | MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737693 | FOXA1 | forkhead box A1 | 9598 | VGNC:12637 | OMA, EggNOG |
| Macaque | 697909 | FOXA1 | forkhead box A1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15375 | Foxa1 | forkhead box A1 | 10090 | MGI:1347472 | Inparanoid, OMA, EggNOG |
| Rat | 25098 | Foxa1 | forkhead box A1 | 10116 | RGD:2807 | Inparanoid, OMA |
| Dog | 490657 | FOXA1 | forkhead box A1 | 9615 | VGNC:53490 | Inparanoid, OMA |
| Cow | 503579 | FOXA1 | forkhead box A1 | 9913 | VGNC:29077 | Inparanoid, OMA |
| Anole lizard | 100558192 | foxa1 | forkhead box A1 | 28377 | Inparanoid, OMA | |
| Xenopus | 395059 | foxa1 | forkhead box A1 | 8364 | XB-GENE-487352 | Inparanoid, OMA |
| Zebrafish | 30541 | foxa1 | forkhead box A1 | 7955 | ZDB-GENE-990415-78 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Hepatocyte nuclear factor 3-alpha
protein / nucleic acid binding / transcription factor / Hepatocyte nuclear factor 3-alpha
protein / nucleic acid binding / winged helix/forkhead transcription factor / Hepatocyte nuclear factor 3-alpha
protein / nucleic acid binding / DNA binding protein / Hepatocyte nuclear factor 3-alpha
protein / nucleic acid binding / transcription factor / Hepatocyte nuclear factor 3-alpha
protein / nucleic acid binding / winged helix/forkhead transcription factor / Hepatocyte nuclear factor 3-alpha
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / Hepatocyte nuclear factor 3-alpha
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / Hepatocyte nuclear factor 3-alpha
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.