224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Folate receptor alpha |
|---|
Gene and Protein Information
| Gene ID | 2348 |
|---|---|
| Uniprot Accession IDs | P15328 Q53EW2 Q6FGT8 Q6LC90 Q9UCT2 FR-alpha |
| Ensembl ID | ENSP00000377284 |
| Symbol | FOLR FBP FOLR |
| Family | Belongs to the folate receptor family. |
| Sequence | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451401 | FOLR1 | folate receptor 1 | 9598 | VGNC:11775 | OMA, EggNOG |
| Macaque | 718388 | FOLR1 | folate receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14275 | Folr1 | folate receptor 1 (adult) | 10090 | MGI:95568 | Inparanoid, OMA |
| Rat | 171049 | Folr1 | folate receptor 1 | 10116 | RGD:71032 | Inparanoid, OMA, EggNOG |
| Dog | 609612 | FOLR1 | folate receptor 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100059683 | LOC100059683 | folate receptor alpha-like | 9796 | Inparanoid, OMA | |
| Cow | 539750 | FOLR1 | folate receptor 1 (adult) | 9913 | OMA, EggNOG | |
| Pig | FOLR1 | folate receptor alpha precursor [Source:RefSeq peptide;Acc:NP_999476] | 9823 | Inparanoid, OMA | ||
| Opossum | 100015645 | LOC100015645 | folate receptor alpha-like | 13616 | OMA, EggNOG | |
| Chicken | 395638 | FOLR1 | folate receptor 1 | 9031 | CGNC:49417 | OMA, EggNOG |
| Xenopus | 394697 | folr1 | folate receptor 1 (adult) | 8364 | XB-GENE-948101 | OMA, EggNOG |
| Zebrafish | 100073336 | zgc:165502 | zgc:165502 | 7955 | ZDB-GENE-070615-23 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.