FOSL2

DescripciónFos-related antigen 2

Gene and Protein Information

Gene ID2355
Uniprot Accession IDs P15408 B2RD58 B3KP27 B4DYV4 Q6FG46 FRA-2
Ensembl ID ENSP00000264716
Symbol FRA2 FRA2
FamilyBelongs to the bZIP family. Fos subfamily.
Sequence
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque703068FOSL2FOS like 2, AP-1 transcription factor subunit9544Inparanoid, OMA, EggNOG
Mouse14284Fosl2fos-like antigen 210090MGI:102858Inparanoid, OMA, EggNOG
Rat25446Fosl2FOS like 2, AP-1 transcription factor subunit10116RGD:2628Inparanoid, OMA
Dog608412FOSL2FOS like 2, AP-1 transcription factor subunit9615VGNC:40943Inparanoid, OMA, EggNOG
Horse100071081FOSL2FOS like 2, AP-1 transcription factor subunit9796VGNC:18098Inparanoid, OMA, EggNOG
Cow509889FOSL2FOS like 2, AP-1 transcription factor subunit9913VGNC:29076Inparanoid, OMA, EggNOG
OpossumFOSL2FOS like 2, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:3798]13616Inparanoid, EggNOG
PlatypusFOSL2FOS like 2, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:3798]9258OMA, EggNOG
Chicken421416FOSL2FOS like 2, AP-1 transcription factor subunit9031CGNC:7631Inparanoid, OMA, EggNOG
Anole lizard100563265fosl2FOS like 2, AP-1 transcription factor subunit28377Inparanoid, OMA, EggNOG
Xenopus100494449fosl2FOS-like antigen 28364XB-GENE-6258093Inparanoid, OMA, EggNOG
Zebrafish558921fosl2fos-like antigen 27955ZDB-GENE-070209-164Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.