🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

FOSL2

DescripciónFos-related antigen 2

Gene and Protein Information

Gene ID2355
Uniprot Accession IDs P15408 B2RD58 B3KP27 B4DYV4 Q6FG46 FRA-2
Ensembl ID ENSP00000264716
Symbol FRA2 FRA2
FamilyBelongs to the bZIP family. Fos subfamily.
Sequence
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque703068FOSL2FOS like 2, AP-1 transcription factor subunit9544Inparanoid, OMA, EggNOG
Mouse14284Fosl2fos-like antigen 210090MGI:102858Inparanoid, OMA, EggNOG
Rat25446Fosl2FOS like 2, AP-1 transcription factor subunit10116RGD:2628Inparanoid, OMA
Dog608412FOSL2FOS like 2, AP-1 transcription factor subunit9615VGNC:40943Inparanoid, OMA, EggNOG
Horse100071081FOSL2FOS like 2, AP-1 transcription factor subunit9796VGNC:18098Inparanoid, OMA, EggNOG
Cow509889FOSL2FOS like 2, AP-1 transcription factor subunit9913VGNC:29076Inparanoid, OMA, EggNOG
OpossumFOSL2FOS like 2, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:3798]13616Inparanoid, EggNOG
PlatypusFOSL2FOS like 2, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:3798]9258OMA, EggNOG
Chicken421416FOSL2FOS like 2, AP-1 transcription factor subunit9031CGNC:7631Inparanoid, OMA, EggNOG
Anole lizard100563265fosl2FOS like 2, AP-1 transcription factor subunit28377Inparanoid, OMA, EggNOG
Xenopus100494449fosl2FOS-like antigen 28364XB-GENE-6258093Inparanoid, OMA, EggNOG
Zebrafish558921fosl2fos-like antigen 27955ZDB-GENE-070209-164Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.