SLC2A8

DescripciónSolute carrier family 2, facilitated glucose transporter member 8

Gene and Protein Information

Gene ID29988
Uniprot Accession IDs Q9NY64 Q8WUZ9 Q9NSC4
Ensembl ID ENSP00000362469
Symbol GLUT8 GLUTX1 GLUT8 GLUTX1
FamilyBelongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
Sequence
MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp739414SLC2A8solute carrier family 2 member 89598VGNC:8933OMA, EggNOG
Macaque701073SLC2A8solute carrier family 2 member 89544Inparanoid, OMA, EggNOG
Mouse56017Slc2a8solute carrier family 2, (facilitated glucose transporter), member 810090MGI:1860103Inparanoid, OMA, EggNOG
Rat85256Slc2a8solute carrier family 2 member 810116RGD:620611Inparanoid, OMA, EggNOG
Dog480717SLC2A8solute carrier family 2 member 89615VGNC:46344Inparanoid, OMA, EggNOG
Horse100070552SLC2A8solute carrier family 2 member 89796VGNC:23145Inparanoid, OMA, EggNOG
Cow282867SLC2A8solute carrier family 2 member 89913VGNC:34803Inparanoid, OMA, EggNOG
Pig100125551SLC2A8solute carrier family 2 member 89823Inparanoid, OMA, EggNOG
Opossum100020584SLC2A8solute carrier family 2 member 813616Inparanoid, EggNOG
Chicken378802SLC2A8solute carrier family 2 member 89031CGNC:49126Inparanoid, OMA
Anole lizard100566203slc2a8solute carrier family 2 member 828377Inparanoid, OMA
Xenopus100486943slc2a8solute carrier family 2 member 88364XB-GENE-492572Inparanoid, OMA
Zebrafish373140slc2a8solute carrier family 2 (facilitated glucose transporter), member 87955ZDB-GENE-030829-25Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.