Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Solute carrier family 2, facilitated glucose transporter member 8 |
|---|
Gene and Protein Information
| Gene ID | 29988 |
|---|---|
| Uniprot Accession IDs | Q9NY64 Q8WUZ9 Q9NSC4 |
| Ensembl ID | ENSP00000362469 |
| Symbol | GLUT8 GLUTX1 GLUT8 GLUTX1 |
| Family | Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily. |
| Sequence | MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739414 | SLC2A8 | solute carrier family 2 member 8 | 9598 | VGNC:8933 | OMA, EggNOG |
| Macaque | 701073 | SLC2A8 | solute carrier family 2 member 8 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 56017 | Slc2a8 | solute carrier family 2, (facilitated glucose transporter), member 8 | 10090 | MGI:1860103 | Inparanoid, OMA, EggNOG |
| Rat | 85256 | Slc2a8 | solute carrier family 2 member 8 | 10116 | RGD:620611 | Inparanoid, OMA, EggNOG |
| Dog | 480717 | SLC2A8 | solute carrier family 2 member 8 | 9615 | VGNC:46344 | Inparanoid, OMA, EggNOG |
| Horse | 100070552 | SLC2A8 | solute carrier family 2 member 8 | 9796 | VGNC:23145 | Inparanoid, OMA, EggNOG |
| Cow | 282867 | SLC2A8 | solute carrier family 2 member 8 | 9913 | VGNC:34803 | Inparanoid, OMA, EggNOG |
| Pig | 100125551 | SLC2A8 | solute carrier family 2 member 8 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100020584 | SLC2A8 | solute carrier family 2 member 8 | 13616 | Inparanoid, EggNOG | |
| Chicken | 378802 | SLC2A8 | solute carrier family 2 member 8 | 9031 | CGNC:49126 | Inparanoid, OMA |
| Anole lizard | 100566203 | slc2a8 | solute carrier family 2 member 8 | 28377 | Inparanoid, OMA | |
| Xenopus | 100486943 | slc2a8 | solute carrier family 2 member 8 | 8364 | XB-GENE-492572 | Inparanoid, OMA |
| Zebrafish | 373140 | slc2a8 | solute carrier family 2 (facilitated glucose transporter), member 8 | 7955 | ZDB-GENE-030829-25 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.