HLF

DescripciónHepatic leukemia factor

Gene and Protein Information

Gene ID3131
Uniprot Accession IDs Q16534 A8K1X8 Q6FHS9
Ensembl ID ENSP00000226067
FamilyBelongs to the bZIP family. PAR subfamily.
Sequence
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455140HLFHLF, PAR bZIP transcription factor9598VGNC:10210OMA, EggNOG
Macaque706623HLFHLF, PAR bZIP transcription factor9544Inparanoid, OMA, EggNOG
Mouse217082Hlfhepatic leukemia factor10090MGI:96108Inparanoid, OMA, EggNOG
Rat690286HlfHLF, PAR bZIP transcription factor10116RGD:1582828Inparanoid, OMA, EggNOG
Dog609564HLFHLF, PAR bZIP transcription factor9615VGNC:49094Inparanoid, OMA, EggNOG
Horse100070549HLFHLF, PAR bZIP transcription factor9796VGNC:50481Inparanoid, OMA, EggNOG
Cow516069HLFHLF, PAR bZIP transcription factor9913VGNC:50275Inparanoid, OMA, EggNOG
Opossum100012192HLFHLF, PAR bZIP transcription factor13616Inparanoid, OMA, EggNOG
Platypus100093311HLFHLF, PAR bZIP transcription factor9258Inparanoid, OMA, EggNOG
Chicken417395HLFHLF, PAR bZIP transcription factor9031CGNC:2216Inparanoid, OMA, EggNOG
Anole lizard100567087hlfHLF, PAR bZIP transcription factor28377Inparanoid, OMA, EggNOG
Xenopus100489797hlfhepatic leukemia factor8364XB-GENE-955698Inparanoid, OMA, EggNOG
Zebrafish768192hlfahepatic leukemia factor a7955ZDB-GENE-061013-159Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.