🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

HMGB2

DescripciónHigh mobility group protein B2

Gene and Protein Information

Gene ID3148
Uniprot Accession IDs P26583 B2R4K8 D3DP37 Q5U072
Ensembl ID ENSP00000296503
Symbol HMG2 HMG2
FamilyBelongs to the HMGB family.
Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp461606HMGB2high mobility group box 29598VGNC:613OMA, EggNOG
Macaque697057HMGB2high mobility group box 29544Inparanoid, OMA, EggNOG
Mouse97165Hmgb2high mobility group box 210090MGI:96157Inparanoid, OMA, EggNOG
Rat29395Hmgb2high mobility group box 210116Inparanoid, OMA
Dog486068HMGB2high mobility group box 29615VGNC:41710Inparanoid, OMA, EggNOG
Horse100061162HMGB2high mobility group box 29796VGNC:18803Inparanoid, OMA, EggNOG
Cow540444HMGB2high mobility group box 29913Inparanoid, OMA, EggNOG
Pig397130HMGB2high mobility group box 29823Inparanoid, EggNOG
Opossum100014287HMGB2high mobility group box 213616Inparanoid, OMA, EggNOG
Chicken396482HMGB2high mobility group box 29031CGNC:8169Inparanoid, OMA, EggNOG
Anole lizard100553705hmgb2high mobility group box 228377Inparanoid, OMA, EggNOG
Zebrafish641484hmgb2ahigh mobility group box 2a7955ZDB-GENE-051120-126Inparanoid, OMA, EggNOG
C. elegans175890hmg-1.2High mobility group protein 1.26239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    chromatin/chromatin-binding protein    /    High mobility group protein B2
protein    /    nucleic acid binding    /    signaling molecule    /    High mobility group protein B2
protein    /    nucleic acid binding    /    HMG box transcription factor    /    High mobility group protein B2
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Chromatin/chromatin-binding protein    /    High mobility group protein B2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.