🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GPR12

DescripciónG-protein coupled receptor 12

Gene and Protein Information

Gene ID2835
Uniprot Accession IDs P47775 Q5T8P3
Ensembl ID ENSP00000384932
Symbol GPCR12 GPCR21 PPP1R84
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse14738Gpr12G-protein coupled receptor 1210090MGI:101909Inparanoid, OMA, EggNOG
Rat80840Gpr12G protein-coupled receptor 1210116RGD:68333Inparanoid, OMA, EggNOG
Dog486034GPR12G protein-coupled receptor 129615VGNC:41395Inparanoid, OMA
Horse100050970GPR12G protein-coupled receptor 129796VGNC:18508Inparanoid, OMA
Cow522747GPR12G protein-coupled receptor 129913VGNC:29547Inparanoid, OMA
Pig100736641GPR12G protein-coupled receptor 129823Inparanoid, OMA, EggNOG
Opossum100019540GPR12G protein-coupled receptor 1213616Inparanoid, OMA, EggNOG
PlatypusGPR12G protein-coupled receptor 12 [Source:HGNC Symbol;Acc:HGNC:4466]9258OMA, EggNOG
Chicken428079GPR12G protein-coupled receptor 129031CGNC:12847Inparanoid, OMA
Anole lizard100552481gpr12G protein-coupled receptor 1228377Inparanoid, OMA, EggNOG
Zebrafish565609gpr12G protein-coupled receptor 127955ZDB-GENE-100209-3Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 12
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 12

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.