Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Homeobox protein engrailed-1 |
|---|
Gene and Protein Information
| Gene ID | 2019 |
|---|---|
| Uniprot Accession IDs | Q05925 Q4ZG44 Homeobox protein en-1 |
| Ensembl ID | ENSP00000295206 |
| Family | Belongs to the engrailed homeobox family. |
| Sequence | MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 749965 | EN1 | engrailed homeobox 1 | 9598 | VGNC:10775 | OMA, EggNOG |
| Mouse | 13798 | En1 | engrailed 1 | 10090 | MGI:95389 | Inparanoid, OMA, EggNOG |
| Rat | 685360 | En1 | engrailed homeobox 1 | 10116 | RGD:1595088 | Inparanoid, OMA |
| Cow | 529707 | EN1 | engrailed homeobox 1 | 9913 | VGNC:28487 | OMA, EggNOG |
| Pig | 100516112 | EN1 | engrailed homeobox 1 | 9823 | OMA, EggNOG | |
| Opossum | 100014221 | EN1 | engrailed homeobox 1 | 13616 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein engrailed-1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein engrailed-1
protein / nucleic acid binding / DNA binding protein / Homeobox protein engrailed-1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein engrailed-1
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein engrailed-1
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein engrailed-1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.