GPR18

DescripciónN-arachidonyl glycine receptor

Gene and Protein Information

Gene ID2841
Uniprot Accession IDs Q14330 Q6GTM3 Q96HI6 Q9H2L2 NAGly receptor
Ensembl ID ENSP00000343428
Symbol GPCRW
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIYMMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRYMAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQVLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSMRRKSFRSGSLRSLSNINSEML
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp738311GPR18G protein-coupled receptor 189598VGNC:5065OMA, EggNOG
Macaque698714GPR18G protein-coupled receptor 189544Inparanoid, OMA
Mouse110168Gpr18G protein-coupled receptor 1810090MGI:107859Inparanoid, OMA, EggNOG
Rat679957Gpr18G protein-coupled receptor 1810116RGD:1304889Inparanoid, OMA, EggNOG
Dog485531GPR18G protein-coupled receptor 189615VGNC:41420Inparanoid, OMA, EggNOG
Horse100147633GPR18G protein-coupled receptor 189796VGNC:18531Inparanoid, OMA, EggNOG
Cow540038GPR18G protein-coupled receptor 189913VGNC:29574Inparanoid, OMA, EggNOG
Chicken100858263GPR18G protein-coupled receptor 189031CGNC:66127OMA, EggNOG
Anole lizard103278302gpr18G protein-coupled receptor 1828377Inparanoid, OMA, EggNOG
XenopusGPR18G protein-coupled receptor 18 [Source:HGNC Symbol;Acc:HGNC:4472]8364OMA, EggNOG
Zebrafish556711gpr18G protein-coupled receptor 187955ZDB-GENE-070912-159Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    N-arachidonyl glycine receptor

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.